PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G26930.1
Common NameAtMYB97, MYB97
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 389aa    MW: 43578.4 Da    PI: 5.8382
Description myb domain protein 97
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G26930.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.3e-142168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ede l+ +v+++G g+W+++ ++  + R++k+c++rw ++l
      AT4G26930.1 21 KGPWTVAEDETLAAYVREYGEGNWNSVQKKTWLARCGKSCRLRWANHL 68
                     79******************************************9986 PP

2Myb_DNA-binding52.79.5e-1774117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l+++++ qlG++ W++ a+ ++ gRt++++k++w++
      AT4G26930.1  74 KGSFTPEEERLIIQLHSQLGNK-WARMAAQLP-GRTDNEIKNYWNT 117
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8391668IPR017930Myb domain
SMARTSM007172.4E-102070IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-2920115IPR009057Homeodomain-like
PfamPF002491.1E-122168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-222275IPR009057Homeodomain-like
CDDcd001674.20E-102368No hitNo description
PROSITE profilePS5129425.99469123IPR017930Myb domain
SMARTSM007172.6E-1673121IPR001005SANT/Myb domain
PfamPF002491.8E-1574117IPR001005SANT/Myb domain
CDDcd001673.05E-1276119No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2576121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MIVYGGGASE DGEGGGVVLK KGPWTVAEDE TLAAYVREYG EGNWNSVQKK TWLARCGKSC  60
RLRWANHLRP NLRKGSFTPE EERLIIQLHS QLGNKWARMA AQLPGRTDNE IKNYWNTRLK  120
RFQRQGLPLY PPEYSQNNHQ QQMYPQQPSS PLPSQTPASS FTFPLLQPPS LCPKRCYNTA  180
FSPKASYISS PTNFLVSSPT FLHTHSSLSS YQSTNPVYSM KHELSSNQIP YSASLGVYQV  240
SKFSDNGDCN QNLNTGLHTN TCQLLEDLME EAEALADSFR APKRRQIMAA LEDNNNNNNF  300
FSGGFGHRVS SNSLCSLQGL TPKEDESLQM NTMQDEDITK LLDWGSESEE ISNGQSSVIT  360
TENNLVLDDH QFAFLFPVDD DTNNLPGIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-31181211103C-Myb DNA-Binding Domain
1msf_C2e-31181211103C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279284RAPKRR
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO58233360.0
Genevisible253939_at0.0
Expression AtlasAT4G26930-
AtGenExpressAT4G26930-
ATTED-IIAT4G26930-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB97).
Function -- GeneRIF ? help Back to Top
  1. All these results indicate that MYB97, MYB101 and MYB120 participate in pollen tube reception, possibly by controlling the expression of downstream genes.
    [PMID: 24278028]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G26930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G18570
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G26930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1760020.0AF176002.1 Arabidopsis thaliana putative transcription factor (MYB97) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194423.10.0myb domain protein 97
TrEMBLA0MFA00.0A0MFA0_ARATH; Putative uncharacterized protein (Fragment)
STRINGAT4G26930.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99391934
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Becker JD,Boavida LC,Carneiro J,Haury M,Feij
    Transcriptional profiling of Arabidopsis tissues reveals the unique characteristics of the pollen transcriptome.
    Plant Physiol., 2003. 133(2): p. 713-25
    [PMID:14500793]
  4. Verelst W,Saedler H,M√ľnster T
    MIKC* MADS-protein complexes bind motifs enriched in the proximal region of late pollen-specific Arabidopsis promoters.
    Plant Physiol., 2007. 143(1): p. 447-60
    [PMID:17071640]
  5. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  6. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  7. Leydon AR, et al.
    Three MYB transcription factors control pollen tube differentiation required for sperm release.
    Curr. Biol., 2013. 23(13): p. 1209-14
    [PMID:23791732]
  8. Liang Y, et al.
    MYB97, MYB101 and MYB120 function as male factors that control pollen tube-synergid interaction in Arabidopsis thaliana fertilization.
    PLoS Genet., 2013. 9(11): p. e1003933
    [PMID:24278028]
  9. Frerigmann H,Berger B,Gigolashvili T
    bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis.
    Plant Physiol., 2014. 166(1): p. 349-69
    [PMID:25049362]